Protein Info for AO353_16625 in Pseudomonas fluorescens FW300-N2E3

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 859 transmembrane" amino acids 632 to 647 (16 residues), see Phobius details TIGR01070: DNA mismatch repair protein MutS" amino acids 11 to 856 (846 residues), 1290.5 bits, see alignment E=0 PF01624: MutS_I" amino acids 12 to 123 (112 residues), 150.7 bits, see alignment E=4.6e-48 PF05188: MutS_II" amino acids 132 to 257 (126 residues), 118.1 bits, see alignment E=9.2e-38 PF05192: MutS_III" amino acids 273 to 562 (290 residues), 167.3 bits, see alignment E=1.4e-52 PF05190: MutS_IV" amino acids 431 to 521 (91 residues), 100.3 bits, see alignment E=1.5e-32 PF00488: MutS_V" amino acids 613 to 799 (187 residues), 283.7 bits, see alignment E=2e-88

Best Hits

Swiss-Prot: 96% identical to MUTS_PSEPF: DNA mismatch repair protein MutS (mutS) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 96% identity to pba:PSEBR_a1098)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VVZ1 at UniProt or InterPro

Protein Sequence (859 amino acids)

>AO353_16625 DNA mismatch repair protein MutS (Pseudomonas fluorescens FW300-N2E3)
MNKALSDLSSHTPMMQQYWRLKNQHPDQLMFYRMGDFYEIFYEDAKKAAKLLDITLTARG
QSAGQAIPMCGIPYHAAEGYLAKLVKLGESVVICEQVGDPATSKGPVDRQVVRIITPGTV
SDEALLDERRDNLIAAVLGDERLFGLAVLDITSGNFSVLEIKGWENLLAELERVNPVELM
IPDDWPKDLPAEKRRGVRRRAPWDFERDSALKSLCQQFSTQDLKGFGCENLTLAIGAAGC
LLSYAKETQRTALPHLRSLRHERLDDTVVLDGASRRNLELDTNLAGGRENTLQSVVDRCQ
TAMGSRLLTRWLNRPLRDLSVLLARQTSITCLLDGYRFEKLQPQLKEIGDIERILARIGL
RNARPRDLARLRDALGALPELQVAMTELEAPHLHQLAVTTSTYPELAALLEKAIIDNPPA
VIRDGGVLKTGYDAELDELQSLSENAGQFLIDLEAREKARTGLANLKVGYNRIHGYFIEL
PSKQAEQAPADYIRRQTLKGAERFITPELKAFEDKALSAKSRALAREKMLYEALLEDLIS
QLPPLQDTAAALAELDVLSNLAERALNLDLNCPRFVSEPCMRISQGRHPVVEQVLTTPFV
ANDLSLDDSTRMLVITGPNMGGKSTYMRQTALIVLLAHIGSFVPAASCELSLVDRIFTRI
GSSDDLAGGRSTFMVEMSETANILHNATERSLVLMDEVGRGTSTFDGLSLAWAAAERLAQ
LRAYTLFATHYFELTVLPESQPLVANVHLNATEHNERIVFLHHVLPGPASQSYGLAVAQL
AGVPTEVIVRAREHLGRLETTALPHETAQPSKGKPAAPQQSDMFASLPHPVLDELAKLNL
DDMTPRRALEMLYTLKTRI