Protein Info for AO353_16465 in Pseudomonas fluorescens FW300-N2E3

Annotation: elongation factor Ts

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 TIGR00116: translation elongation factor Ts" amino acids 1 to 282 (282 residues), 311.2 bits, see alignment E=3.3e-97 PF00889: EF_TS" amino acids 71 to 265 (195 residues), 194.5 bits, see alignment E=8.3e-62

Best Hits

Swiss-Prot: 96% identical to EFTS_PSEFS: Elongation factor Ts (tsf) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02357, elongation factor Ts (inferred from 96% identity to pfs:PFLU1271)

Predicted SEED Role

"Translation elongation factor Ts"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WDY6 at UniProt or InterPro

Protein Sequence (287 amino acids)

>AO353_16465 elongation factor Ts (Pseudomonas fluorescens FW300-N2E3)
MAEITAALVKELRERTGEGMMDCKKALTKAGGDIEKAIDDMRASGAIKAAKKAGNVAAEG
AIALKEDGKSAVLLEVNSQTDFLALQDDFKVFVAASVEKAFADKMTTVEPLIEAQEAARL
VLVGKVGENVNIRRLTRVEGDVVGGYLHGNKIGVAVVLKGGDVELAKDIAMHVAATNPEF
LLPSEVSAEAIEREKGVFLTLNADKIAGKPENIVENMVKGRISKFLAEASLVEQAFVKNP
EIKVGELAKKAGAEIVSFTYFKVGEGIEKPVDNFAEEVAAQLAAAKQ