Protein Info for AO353_16455 in Pseudomonas fluorescens FW300-N2E3

Annotation: methionine aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 TIGR00500: methionine aminopeptidase, type I" amino acids 4 to 249 (246 residues), 338 bits, see alignment E=1.6e-105 PF00557: Peptidase_M24" amino acids 12 to 241 (230 residues), 195.7 bits, see alignment E=4.3e-62

Best Hits

Swiss-Prot: 64% identical to MAP1_ECOL6: Methionine aminopeptidase (map) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 96% identity to pba:PSEBR_a1064)

MetaCyc: 64% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WLA2 at UniProt or InterPro

Protein Sequence (260 amino acids)

>AO353_16455 methionine aminopeptidase (Pseudomonas fluorescens FW300-N2E3)
MTVTLKTPEDIAKMRIAGKLAADVLEMIAEYVKPGVTTEELDRICHDYIVNEQKAIPAPL
NYKGFPKSICTSINHVVCHGIPNEKPLKDGDTLNIDVTVIKDGYHGDTSRMFHVGTVPVW
AERLSQVTQECMYKAIELVKPGCRLGDIGEVIQKHAEKNGFSVVREFCGHGIGKVFHEEP
QILHYGRAGTGMELKAGMTFTIEPMINQGRADTKVLGDGWTAITKDRKLSAQWEHTLLVT
ETGYEIFTLRSDDTIPRVSA