Protein Info for AO353_16200 in Pseudomonas fluorescens FW300-N2E3

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 42 to 68 (27 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 152 to 179 (28 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details PF01810: LysE" amino acids 16 to 207 (192 residues), 123.9 bits, see alignment E=3e-40

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfo:Pfl01_4548)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H098 at UniProt or InterPro

Protein Sequence (212 amino acids)

>AO353_16200 lysine transporter LysE (Pseudomonas fluorescens FW300-N2E3)
MIPTHDLLIFAAASLLLVLTPGPNMIYLISRSICQGRKAGVTSLLGVVAGFFVHLFCAAA
GLTALFMAVPMAYEALKWAGALYLLWMAWQAVKPGARSPFEAQQLPPDSSRKLMLMGFFT
SALNPKIAVFYLSVFPQFISPEHGSVFTQSIALGLTQISVSFTVNLFIALFAAGIASWFV
NNPSWLAVQRYFMGFVLAGLAVRLMSEQRRMA