Protein Info for AO353_16150 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 transmembrane" amino acids 12 to 21 (10 residues), see Phobius details amino acids 55 to 86 (32 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 259 to 276 (18 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details PF13231: PMT_2" amino acids 47 to 209 (163 residues), 52.3 bits, see alignment E=4.1e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VVQ9 at UniProt or InterPro

Protein Sequence (542 amino acids)

>AO353_16150 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
VLVMMLAIIVRFYCISLPYFWTDEAFSALVGVQSPGRIWFHLGHDVHPPLYFLVLHAWMA
IFGEGVFAIRALSALAGVATVALGMWLMRLISTPRVALLAGLFLALLPISVRYSQEARMY
TLEGVWLLGATIALVYWLKSARNRYLMSYLVLMTAALYTHYLAVLCLLSHWLYLVVLRLQ
RDKTLHYLSRPTWWGTNVAIVVLYIPWLISLGNELFLNTEKLETGGDIFWIPELTIYTLP
SAVWKFLTVKSGLEFASPIYVLLPALVMASVVWVGFKERSRLKLELLLVIYVLLPVLIVF
VVSFGFPIFVERYMAFAALGLPMIVALAISRIAHRTRALAWVSALLMVGVQLMGLNTIYQ
QQDDLDDPRNASQYPLDDIVSRINENAIAGDNIIVDGAYWYYSVAYYNRSDIQPRLYQAP
WDSSTAHRPNGYGASTLIYQDRDKVFLDNLVSVSPEIKRVWWVTSTRLADEENHFPGNWQ
CVFAQGLGDMELRLYVTRAWAEQITTATTTGGGCATQPPDNREYALHDIGLKAVSPSHLP
HP