Protein Info for AO353_16145 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 168 to 194 (27 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details amino acids 322 to 344 (23 residues), see Phobius details amino acids 351 to 370 (20 residues), see Phobius details PF13231: PMT_2" amino acids 66 to 228 (163 residues), 45.3 bits, see alignment E=5.9e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WWH0 at UniProt or InterPro

Protein Sequence (507 amino acids)

>AO353_16145 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
VVSQVNRSSASTLQSTCWILLIILVAAGVRFYDLGKPAIWADEGFTLLLSSYSPSQILFH
TARDVHPPLYYLLLHEWMNLFGQGVFAARSLSALADVVTVGLGIWLVRLVSTQRAAMLAG
TMLALLPIAVRYSQEIRMYALLALLMVSATIAFVYWVKGSGRHWPLAIYTLLMVAGFYTH
YFAAVCMAAHWAWLLVLRFQRVAQQRQLLAPAWWMANGTVVLLFMPWVPSLMNQLRFSGF
NWIAPLDVPTVVSAFWQFVSYSDGPKESVWLFYSVPLLMLLVSAVIVMRDTSEKRFSTLL
VIYTWFPLVLIAGVSLVRPLFIYRYFVFAALGFPMILAMSLDALWERAKTLFFVLLLLIV
SMESVGLYNVHQRGHIVYAEVNKVDALADYINAFARPDDGVVVVNRFLYYPFAYYNKTGV
TPMLYTPLQKDGTSGRPDGYQTSTLTQQNADKVYLDNLETLTPGSGRVWVLDGRGDGAQQ
VVIPENWRLLDTFIQGDGDVRLFSVSP