Protein Info for AO353_16140 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 156 to 185 (30 residues), see Phobius details amino acids 194 to 219 (26 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 294 to 319 (26 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 352 to 371 (20 residues), see Phobius details PF14264: Glucos_trans_II" amino acids 32 to 336 (305 residues), 84.4 bits, see alignment E=4.6e-28

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WJ79 at UniProt or InterPro

Protein Sequence (501 amino acids)

>AO353_16140 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MKVASVLSRALSGREVFVFFLLATLVYILPLILVDYYYIDDNWRSLAAGTGWAGQGRLLV
ELFYNTLSFTSGAPDMFPLPLLIATLAMVFALTKLTMHYYKVPTVSCCLVFLPLWYNPFF
LQNLSYQYDGPATALSLVAVIYAVAFQHKAGVVQVLVPGALIAMGLSLYQLSINVFLGLC
CIEFVRALDNKESLACLLSIAGVKAVQLVAGLIIYFLLAYPLMSHERLEMIPFNTSGLLL
ILNNVGVLVGKIGLLFQGGNRWLAWMVVVFAVVGGGRVGRNIIQGKETSLNKILLFFLYV
LMVLFLVFLVSGSALLFRFFNEGARTLLGFGVLLVFLFYLAHQWLVTVDARLGVVLIVPL
LSMLSMSYAYGRVLNLQKEFGLNAEFNMAYDIASHPGLREAKRIYMAISYSNSWLLSAKG
SFERIPVLKYILNIDFYMLSENLLREGITNVVIENERKNATLVGYQRYTPVVDSKFYSMY
VIGDYGFIVMKEVPSSGEDKW