Protein Info for AO353_15975 in Pseudomonas fluorescens FW300-N2E3

Annotation: GntR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00392: GntR" amino acids 3 to 66 (64 residues), 59 bits, see alignment E=3e-20 TIGR02404: trehalose operon repressor" amino acids 3 to 234 (232 residues), 323.1 bits, see alignment E=5.5e-101 PF07702: UTRA" amino acids 90 to 226 (137 residues), 120.1 bits, see alignment E=6.4e-39

Best Hits

Swiss-Prot: 44% identical to TRER_BACSU: HTH-type transcriptional regulator TreR (treR) from Bacillus subtilis (strain 168)

KEGG orthology group: K03486, GntR family transcriptional regulator, trehalose operon transcriptional repressor (inferred from 92% identity to pfl:PFL_4935)

Predicted SEED Role

"Trehalose operon transcriptional repressor" in subsystem Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VQV6 at UniProt or InterPro

Protein Sequence (234 amino acids)

>AO353_15975 GntR family transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MSKYNQIYSDLLASITTERLERGARLPSETELMDSYQASRGTVRKAIELLQERGFAQKIH
GKGTFVLSTNPIEFQLGGIVSFQETYPRLGNDVSTEVVEFEQIPLQGALLEHLKAEEGSL
ITRIKRVRRIDGKRVILDINHFVAELIPGLNREIAEHSIYAFIEQTLQLQIAYAQRTIEA
MPRSKDDQQHLDLDGQSHVIVVSNQTFLQDGRQFEYTESRHTLDKFYFSDVARR