Protein Info for AO353_15910 in Pseudomonas fluorescens FW300-N2E3

Annotation: ribosome-associated GTPase EngA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 TIGR03594: ribosome-associated GTPase EngA" amino acids 3 to 450 (448 residues), 576.2 bits, see alignment E=7.1e-177 TIGR00231: small GTP-binding protein domain" amino acids 4 to 157 (154 residues), 74.5 bits, see alignment E=1.2e-24 amino acids 194 to 356 (163 residues), 80.8 bits, see alignment E=1.4e-26 PF01926: MMR_HSR1" amino acids 5 to 119 (115 residues), 106 bits, see alignment E=6.3e-34 amino acids 196 to 314 (119 residues), 96.8 bits, see alignment E=4.3e-31 PF02421: FeoB_N" amino acids 5 to 135 (131 residues), 58.1 bits, see alignment E=3.9e-19 amino acids 195 to 356 (162 residues), 50 bits, see alignment E=1.2e-16 PF00009: GTP_EFTU" amino acids 195 to 363 (169 residues), 40 bits, see alignment E=1.7e-13 PF14714: KH_dom-like" amino acids 370 to 450 (81 residues), 94.3 bits, see alignment E=2.2e-30

Best Hits

Swiss-Prot: 96% identical to DER_PSEF5: GTPase Der (der) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03977, GTP-binding protein (inferred from 97% identity to pba:PSEBR_a940)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WL19 at UniProt or InterPro

Protein Sequence (489 amino acids)

>AO353_15910 ribosome-associated GTPase EngA (Pseudomonas fluorescens FW300-N2E3)
MVPVIALVGRPNVGKSTLFNRLTRTRDAIVGDLSGLTRDRQYGEAKWQGRSYILVDTGGI
SGDEHGMDEKMAEQSLLAIEEADVVLFLVDAKAGFTAADQMIAEHLRKRNKRSYVVANKV
DNIDPEMARAEFAPLGMGHAIPIAGAHGRGITQMLEIALSDFPKDSEEPEDGEEEIVAEG
EEAKRIPGPSEKDGIKIAIIGRPNVGKSTLVNRMLGEDRVIVYDQPGTTRDSIYIPFERN
DEKYTLIDTAGVRKRGKIHEEVEKFSVVKTLQAIKDANVVIFVMDAREGVVDHDLNLLGF
ALEAGRALVIAINKWDGMTPSERDFVKVELQRRLFFVDFADIHFISALHGTGVGNLYASV
QNSFKSAVTRWPTNRLTQILEDAVGEHAPPMVNNRRIKLRYAHLGGANPPIIVIHGNQVE
KVPKSYVRYLENTYRRVLKLVGTPIRIEFKGGENPYEGNKNTLTDRQVNKKRRLMTHHKK
ADKKRRDKR