Protein Info for AO353_15840 in Pseudomonas fluorescens FW300-N2E3

Annotation: scaffolding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 PF01592: NifU_N" amino acids 2 to 125 (124 residues), 181.3 bits, see alignment E=3.9e-58 TIGR01999: FeS cluster assembly scaffold IscU" amino acids 3 to 125 (123 residues), 229.6 bits, see alignment E=3.8e-73

Best Hits

Swiss-Prot: 94% identical to ISCU_AZOVI: Iron-sulfur cluster assembly scaffold protein IscU (iscU) from Azotobacter vinelandii

KEGG orthology group: K04488, nitrogen fixation protein NifU and related proteins (inferred from 95% identity to pfs:PFLU5067)

MetaCyc: 81% identical to scaffold protein for iron-sulfur cluster assembly (Escherichia coli K-12 substr. MG1655)
RXN-14381

Predicted SEED Role

"Iron-sulfur cluster assembly scaffold protein IscU" in subsystem Wyeosine-MimG Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0F4TRE3 at UniProt or InterPro

Protein Sequence (128 amino acids)

>AO353_15840 scaffolding protein (Pseudomonas fluorescens FW300-N2E3)
MAYSEKVIDHYENPRNVGKMDAEDPDVGTGMVGAPACGDVMRLQIKVNEQGIIEDAKFKT
YGCGSAIASSSLATEWMKGKTLDEAETIKNTQLAEELALPPVKIHCSVLAEDAIKAAVRD
YKQKKGLI