Protein Info for AO353_15580 in Pseudomonas fluorescens FW300-N2E3

Annotation: 2-oxoisovalerate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 85 to 93 (9 residues), see Phobius details PF02779: Transket_pyr" amino acids 6 to 180 (175 residues), 153.3 bits, see alignment E=5.4e-49 PF02780: Transketolase_C" amino acids 201 to 317 (117 residues), 131.9 bits, see alignment E=1.2e-42

Best Hits

Swiss-Prot: 48% identical to ODPB_BACSU: Pyruvate dehydrogenase E1 component subunit beta (pdhB) from Bacillus subtilis (strain 168)

KEGG orthology group: K00162, pyruvate dehydrogenase E1 component subunit beta [EC: 1.2.4.1] (inferred from 84% identity to pmy:Pmen_3246)

MetaCyc: 46% identical to branched-chain alpha-keto acid decarboxylase E1-beta subunit (Arabidopsis thaliana col)

Predicted SEED Role

"Branched-chain alpha-keto acid dehydrogenase, E1 component, beta subunit (EC 1.2.4.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.2.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1, 1.2.4.4

Use Curated BLAST to search for 1.2.4.1 or 1.2.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WKW4 at UniProt or InterPro

Protein Sequence (328 amino acids)

>AO353_15580 2-oxoisovalerate dehydrogenase (Pseudomonas fluorescens FW300-N2E3)
MSNGKVTLLEAINLALHRAMREDENVIVLGEDVGVNGGVFRATLGLRDSFGFKRVIDTPL
AETMLGGLVIGMAAQGLKPVLEIQFMGFIYAAMEHLVSHASRMRNRTRGRITCPMVLRTP
MGAGIRAPEHHSESTEALFAHIPGLRVVIPSSPARAYGLLLAAIDDPDPVIFLEPTRLYR
MNPQPLIDDGKRLPLDTCFTLREGSDITLISWGASVMETLQAADALAEQGISAEVIDVAS
IKPLDLDTLEASVRKTGRCVIVHEAPRTCGVGAEIAASLYERALLDLQAPILRVTAPDIP
PPLYRQELLYMPNVEDILHACDSVLHHF