Protein Info for AO353_15560 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): Maleylacetoacetate isomerase (EC 5.2.1.2)
Rationale: Specifically important for utilizing L-Phenylalanine. Automated validation from mutant phenotype: the predicted function (5.2.1.2) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: maleylacetoacetate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 2 to 77 (76 residues), 51.8 bits, E=1.7e-17
• TIGR01262: maleylacetoacetate isomerase
  • amino acids 3 to 210 (208 residues), 274.3 bits, E=3.2e-86
• PF13417: GST_N_3
  • amino acids 3 to 82 (80 residues), 60.1 bits, E=4.3e-20
• PF13409: GST_N_2
  • amino acids 10 to 79 (70 residues), 57.8 bits, E=2.7e-19
• PF13410: GST_C_2
  • amino acids 139 to 188 (50 residues), 25.8 bits, E=1.9e-09

Best Hits

Swiss-Prot: 79% identical to MAAI_PSEAE: Maleylacetoacetate isomerase (maiA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01800, maleylacetoacetate isomerase [EC: 5.2.1.2] (inferred from 86% identity to pba:PSEBR_a4694)

MetaCyc: 47% identical to glutathion-dependent maleylpyruvate isomerase (Ralstonia sp. U2)
Maleylpyruvate isomerase. [EC: 5.2.1.4]

Predicted SEED Role

"Maleylacetoacetate isomerase (EC 5.2.1.2) @ Glutathione S-transferase, zeta (EC 2.5.1.18)" (EC 2.5.1.18, EC 5.2.1.2)

MetaCyc Pathways

• L-tyrosine degradation I (5/5 steps found)
• gentisate degradation I (1/3 steps found)
• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• 5-nitroanthranilate degradation (2/6 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)
• pentachlorophenol degradation (4/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (2/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450
• Styrene degradation
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18 or 5.2.1.2 or 5.2.1.4

Sequence Analysis Tools

See A0A0N9WJ02 at UniProt or InterPro

Protein Sequence (211 amino acids)

>AO353_15560 Maleylacetoacetate isomerase (EC 5.2.1.2) (Pseudomonas fluorescens FW300-N2E3)
MELFTYYRSTSSFRVRIALALKGLEYQALPINLIAPQGGEHQQPAYLHINPQGRVPALRT
DEGELLIQSPAIIEYLEERYPQVPLLSKDLARRAHERGVAALIGCDIHPLHNVSVLNQLR
QLGHDEPQVVHWIGHWITQGLAAVEHLIGDEGYCFGNAPGLADVYLIPQLYAAERFNISL
EAYPRIRRVAALAVQHPAFIKAHPANQPDTP