Protein Info for AO353_15550 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): Homogentisate 1,2-dioxygenase (EC 1.13.11.5)
Rationale: Specifically important for utilizing L-tyrosine disodium salt. Automated validation from mutant phenotype: the predicted function (HOMOGENTISATE-12-DIOXYGENASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: homogentisate 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 TIGR01015: homogentisate 1,2-dioxygenase" amino acids 10 to 427 (418 residues), 630.5 bits, see alignment E=6.5e-194 PF20510: HgmA_N" amino acids 12 to 276 (265 residues), 392.5 bits, see alignment E=1e-121 PF04209: HgmA_C" amino acids 277 to 427 (151 residues), 263.7 bits, see alignment E=4.5e-83

Best Hits

Swiss-Prot: 92% identical to HGD_PSEF5: Homogentisate 1,2-dioxygenase (hmgA) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K00451, homogentisate 1,2-dioxygenase [EC: 1.13.11.5] (inferred from 92% identity to pfl:PFL_0967)

Predicted SEED Role

"Homogentisate 1,2-dioxygenase (EC 1.13.11.5)" in subsystem Homogentisate pathway of aromatic compound degradation (EC 1.13.11.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VV07 at UniProt or InterPro

Protein Sequence (434 amino acids)

>AO353_15550 Homogentisate 1,2-dioxygenase (EC 1.13.11.5) (Pseudomonas fluorescens FW300-N2E3)
MNLDSTAPALVYQSGFGNEFSSEALPGALPVGQNSPQKAPYGLYTELFSGTAFTMARSEA
RRTWMYRIQPSANHPAFVKLERQLAGGPLGDVTPNRLRWNPLEIPGEPTDFIDGLVRMAA
NSGSEKPAGISIYHYRANRSMERVFFNADGEWLLVPEQGRLRIATELGVLELEPLEIAVL
PRGLKFRIELLDPQARGYLAENHGAPLRLPDLGPIGSNGLANPRDFLTPVAHYEDLKQPT
TLVQKFLGELWGCELDHSPLNVVAWHGNNVPYKYDLRRFNTIGTVSFDHPDPSIFTVLTS
PTSVHGLANLDFVIFPPRWMVAENTFRPPWFHRNLMNEFMGLIQGTYDAKAEGFLPGGAS
LHSCMSAHGPDGETCTKAINAELAPSKIDNTMAFMFETSQVLRPSRFALDCPQLQNNYDA
CWASLPVTFNPNRR