Protein Info for AO353_15405 in Pseudomonas fluorescens FW300-N2E3

Annotation: RND transporter MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 41 to 372 (332 residues), 247.4 bits, see alignment E=9.3e-78 PF13533: Biotin_lipoyl_2" amino acids 66 to 113 (48 residues), 53.8 bits, see alignment 2e-18 PF16576: HlyD_D23" amino acids 67 to 292 (226 residues), 45.1 bits, see alignment E=1.1e-15 PF13437: HlyD_3" amino acids 177 to 287 (111 residues), 27.1 bits, see alignment E=8.6e-10

Best Hits

Swiss-Prot: 38% identical to MDTA_CROTZ: Multidrug resistance protein MdtA (mdtA) from Cronobacter turicensis (strain DSM 18703 / LMG 23827 / z3032)

KEGG orthology group: None (inferred from 82% identity to pfo:Pfl01_4661)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WQW0 at UniProt or InterPro

Protein Sequence (389 amino acids)

>AO353_15405 RND transporter MFP subunit (Pseudomonas fluorescens FW300-N2E3)
MPIPGKKLLIAALLVTVTAVAIGVALKPATSKLAAPTAIPVRVVSVVERDVPRYVSAIGS
VLSLHSVVIRPQIDGILTRLLVKEGQLVKAGDLLATIDDRSIRASLDQARAQLGENQAQL
QVAEVNLKRYKLLSVDDGVSKQTYDQQQALVNQLKATAQGNQAAIDAAQVQLSYTQIRSP
VTGRVGIRTVDEGNFLRMSDTQGLFSVTQIDPIAVEFSLPQQMLPTLQRLISATPPADVN
AYLGADTNGQTGDLLGEGHLTLIDNQINTNTGTIRAKAEFSNAGQKLWPGQLVTVKIQTA
VDQHVLVVPPSVVQRGLDQHFVYRVNGDKVESVPVQMVYQDSGLNIITGVKAGDVLVSDG
QSRLKPGASVQILGEPPALTQSTAAEQQP