Protein Info for AO353_15390 in Pseudomonas fluorescens FW300-N2E3

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 6 to 455 (450 residues), 440.8 bits, see alignment E=3.3e-136 PF00512: HisKA" amino acids 240 to 304 (65 residues), 53.1 bits, see alignment E=4.1e-18 PF02518: HATPase_c" amino acids 350 to 454 (105 residues), 80.2 bits, see alignment E=2.4e-26 PF14501: HATPase_c_5" amino acids 352 to 455 (104 residues), 33 bits, see alignment E=7.3e-12

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 86% identity to pba:PSEBR_a4613)

Predicted SEED Role

"Heavy metal sensor histidine kinase" in subsystem Cobalt-zinc-cadmium resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VVD8 at UniProt or InterPro

Protein Sequence (456 amino acids)

>AO353_15390 histidine kinase (Pseudomonas fluorescens FW300-N2E3)
MIYPRNSIALRLSGMFTLVAALVFLLIGWALYQQVEKGLALLPAAELDARYSVLESTVGR
FGTPEHWVKINNKLNLLSEEDKRISFWIISGDANYEYGNITPQIRALAQGPTGKRDVQLP
GQPYPMKVLVSQFPAKDQRPPLRFMIGIDTQTFYETQHHLLIALISLAIIGVLLASALGY
WVARIGLKPLIKLSQEAQRLAPPLLSSRLQLSPLPPELNQFVSSFNSTLERVEQAYTRLE
SFNADVAHELRSPLTNLIGQTQVALTRGRSAEHYFEVLQSNLEELERLRSIINDMLFLAS
ADQGSKATKLTTTSLADEVATTLDYLDFILEDAQVKVQVSGDAQVQIEIAHLRRALINLL
NNAVQHTAPGQVIRVRIDVQEHQVSIGVTNPGEPIASEHLSRLFERFYRVDASRSNSGAN
HGLGLAIVKAIALMHGGNVFVHSDNGVNTFGIYLPI