Protein Info for AO353_15365 in Pseudomonas fluorescens FW300-N2E3

Annotation: cell division protein FtsZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 TIGR00065: cell division protein FtsZ" amino acids 11 to 331 (321 residues), 418.9 bits, see alignment E=9.6e-130 PF00091: Tubulin" amino acids 14 to 173 (160 residues), 165.8 bits, see alignment E=1.4e-52 PF12327: FtsZ_C" amino acids 222 to 316 (95 residues), 121.2 bits, see alignment E=1.8e-39

Best Hits

Swiss-Prot: 93% identical to FTSZ_PSEPK: Cell division protein FtsZ (ftsZ) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03531, cell division protein FtsZ (inferred from 99% identity to pba:PSEBR_a4616)

Predicted SEED Role

"Cell division protein FtsZ (EC 3.4.24.-)" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WJL7 at UniProt or InterPro

Protein Sequence (397 amino acids)

>AO353_15365 cell division protein FtsZ (Pseudomonas fluorescens FW300-N2E3)
MFELVDNIPASPVIKVIGVGGGGGNAVNHMVKSNIEGVEFICANTDAQALKSIGARTILQ
LGTGVTKGLGAGANPEVGRQAALEDRERIAEVLQGTNMVFITTGMGGGTGTGAAPIIAEV
AKEMGILTVAVVTRPFPFEGRKRMQIADEGIRLLSESVDSLITIPNEKLLTILGKDASLL
SAFAKADDVLAGAVRGISDIIKRPGMINVDFADVRTVMSEMGMAMMGTGCASGPNRAREA
TEAAIRNPLLEDVNLQGARGILVNITAGPDLSLGEYSDVGSIIEAFASEHAMVKVGTVID
PDMRDELHVTVVATGLGAKIEKPVKVIDNTVHTSMASQPQQQSPARQEQPAVNYRDLDRP
TVMRNQAQAGAATAAKMNPQDDLDYLDIPAFLRRQAD