Protein Info for AO353_15350 in Pseudomonas fluorescens FW300-N2E3

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01820: Dala_Dala_lig_N
  • amino acids 19 to 57 (39 residues), 34.9 bits, 7.2e-12
  • amino acids 67 to 101 (35 residues), 43.7 bits, 1.4e-14
• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 19 to 311 (293 residues), 354.6 bits, E=2.1e-110
• PF02786: CPSase_L_D2
  • amino acids 111 to 302 (192 residues), 44.9 bits, E=3.7e-15
• PF07478: Dala_Dala_lig_C
  • amino acids 119 to 310 (192 residues), 187.7 bits, E=6.4e-59
• PF02222: ATP-grasp
  • amino acids 121 to 279 (159 residues), 32.1 bits, E=3e-11
• PF13535: ATP-grasp_4
  • amino acids 146 to 281 (136 residues), 33.6 bits, E=1e-11

Best Hits

Swiss-Prot: 94% identical to DDL_PSEPF: D-alanine--D-alanine ligase (ddl) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 93% identity to pfl:PFL_5059)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

See A0A0N9WGY9 at UniProt or InterPro

Protein Sequence (322 amino acids)

>AO353_15350 D-alanine--D-alanine ligase (Pseudomonas fluorescens FW300-N2E3)
MTAAYANLFSTIAPKDFGRVAVLFGGKSAEREVSLKSGNAVLEALQSAGVDAFGIDVGDD
FLQRLLNEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHAVLTSEADCILAATELGFPLIVKPAHEGSSIGMAKVTSAAELIEAWKAAST
YDSQVLVEQWIQGPEFTIATLRDQVLPPIALGTPHTFYDYDAKYLASDTQYRIPCGLDSA
KEQELMDLTAKACEALGIAGWGRADVMQDADGQFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAASVGSHVEPRG