Protein Info for AO353_15050 in Pseudomonas fluorescens FW300-N2E3

Annotation: nitrate transport permease nrtB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 181 to 198 (18 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 262 (170 residues), 80.8 bits, see alignment E=5.4e-27

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 96% identity to pfo:Pfl01_4930)

Predicted SEED Role

"Urea carboxylase-related ABC transporter, permease protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WVY5 at UniProt or InterPro

Protein Sequence (267 amino acids)

>AO353_15050 nitrate transport permease nrtB (Pseudomonas fluorescens FW300-N2E3)
MFKRNSWLSRCITPKTGLPVKVIWSASGLAWVLLVGLWAGLSYGGVVPGMFLPTPGAVLD
AAVRLARDGTLGVHVWASLEVVMVGFIVSSLVAVPLGLLMGSFRIVQAFLEPMVNFIRYL
PVTSFVPLFILWIGIGLEQRVSVIIFGVFFQQLVMIADVSKGISKDLINASYTLGSNRRD
AVLHVIAPASLPGVLDTLRVTMGWAWTYLVVAELVAASSGLGYLSLKAMRGFQVDVIFLA
IAIIGLLGLITDQLFRFLRLRIAAWAQ