Protein Info for AO353_14890 in Pseudomonas fluorescens FW300-N2E3

Annotation: amino acid ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 131 to 154 (24 residues), see Phobius details amino acids 160 to 169 (10 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 107 (95 residues), 51.4 bits, see alignment E=6.2e-18 PF00528: BPD_transp_1" amino acids 32 to 212 (181 residues), 65.7 bits, see alignment E=2.3e-22

Best Hits

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 80% identity to pae:PA1257)

Predicted SEED Role

"Probable permease of ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VQB4 at UniProt or InterPro

Protein Sequence (216 amino acids)

>AO353_14890 amino acid ABC transporter (Pseudomonas fluorescens FW300-N2E3)
MYTSSFTSGDFLYLLQGAGTTLLLTFWAMLIGTLLGVACGLVRALLPRVSLPLAWVLDVF
RSVPLLIQFVLLNSFKSIVGLNWSAFTVACVILGAYSTAYCAEIVRGGVLSVPLSTRRAA
RSLGLSHRQDLLHIVLPMATRVAFPGWINLTLAVMKDTSLVLWIGIVELLRASQTIVTRL
QEPLFVLALAGLIYYVMSLVIARLGARLEQRWQEND