Protein Info for AO353_14885 in Pseudomonas fluorescens FW300-N2E3

Annotation: glutamine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 17 to 165 (149 residues), 128.5 bits, E=2.9e-41

Best Hits

Swiss-Prot: 53% identical to GLNQ_BACSU: Glutamine transport ATP-binding protein GlnQ (glnQ) from Bacillus subtilis (strain 168)

KEGG orthology group: K10041, putative glutamine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 86% identity to pap:PSPA7_4136)

MetaCyc: 54% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"ABC-type polar amino acid transport system, ATPase component"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

See A0A0N9WKK8 at UniProt or InterPro

Protein Sequence (240 amino acids)

>AO353_14885 glutamine ABC transporter ATP-binding protein (Pseudomonas fluorescens FW300-N2E3)
MIEIENVRKSFGNLEVVKGVDLTVNKGEVLSIIGGSGSGKSTLLMCINGLEAIQGGQIRV
DGTSVHASGTDLNKLRQKIGIVFQQWNAFPHLTVMENVMLAPRKVLGKSRQEAEEIAVRQ
LTHVGLGDKLKVFPSKLSGGQQQRMAIARALAMSPDYMLFDEATSALDPQLVGEVLDTMR
LLAEEGMTMVLVTHEIRFARDVSDRVAFFRDGKIHEIGSPDQVIGQPQRAETADFLKSVL