Protein Info for AO353_14795 in Pseudomonas fluorescens FW300-N2E3

Annotation: molybdopterin-synthase adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details PF00899: ThiF" amino acids 10 to 245 (236 residues), 229.1 bits, see alignment E=1.8e-72

Best Hits

Swiss-Prot: 55% identical to MOEB_ECOLI: Molybdopterin-synthase adenylyltransferase (moeB) from Escherichia coli (strain K12)

KEGG orthology group: K11996, adenylyltransferase and sulfurtransferase (inferred from 92% identity to pba:PSEBR_a4756)

MetaCyc: 55% identical to molybdopterin-synthase adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11361 [EC: 2.7.7.80]

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeB" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VUM9 at UniProt or InterPro

Protein Sequence (251 amino acids)

>AO353_14795 molybdopterin-synthase adenylyltransferase (Pseudomonas fluorescens FW300-N2E3)
VLNDQELLRYSRQILLQHVDIDGQLRLKQSRVLIVGLGGLGAPVALYLAAAGVGELHLAD
FDTVDLTNLQRQIIHDTDSVGLSKVDSAIRRLTAINPEIQLIAHRTALDEDSLAAAVSAV
DVVLDCSDNFSTREAVNAACVVARKPLVSGAAIRLEGQLSVFDPRRAESPCYHCLYGHGS
EAELTCSEAGVLGPLVGLVGSLQALEALKLLVGFGEPLVGRLLLIDALGARFRELRVKRD
PGCSVCGGRHA