Protein Info for AO353_14645 in Pseudomonas fluorescens FW300-N2E3

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 132 to 149 (18 residues), see Phobius details amino acids 155 to 181 (27 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details PF01810: LysE" amino acids 22 to 211 (190 residues), 106.2 bits, see alignment E=7.6e-35

Best Hits

KEGG orthology group: K05835, threonine efflux protein (inferred from 79% identity to pfl:PFL_5196)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WD89 at UniProt or InterPro

Protein Sequence (213 amino acids)

>AO353_14645 lysine transporter LysE (Pseudomonas fluorescens FW300-N2E3)
VELQHLTYAAPLLSLALLWTVAVVTPGPNFFTTAQLAASCSRRHGVVAALGVATGTVLWG
LAGGLGIKSLFTAAPTLYLAFKIAGGCYLIYLGLKQFKRKPALSLGASAGSSEPYRALFS
AYRQGFLGNMTNPKSALFVATIFATSMPASPPPMLLTLAVITMATLSFSWYCAVALLFAS
HRVAGAYGRSRQWLERFAGSCYVLFGAHLVANR