Protein Info for AO353_14395 in Pseudomonas fluorescens FW300-N2E3

Annotation: poly(A) polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 307 to 326 (20 residues), see Phobius details TIGR01942: poly(A) polymerase" amino acids 25 to 457 (433 residues), 628.8 bits, see alignment E=2.1e-193 PF01743: PolyA_pol" amino acids 56 to 189 (134 residues), 140.5 bits, see alignment E=5.6e-45 PF12627: PolyA_pol_RNAbd" amino acids 216 to 278 (63 residues), 68.2 bits, see alignment E=6.6e-23 PF12626: PolyA_pol_arg_C" amino acids 332 to 449 (118 residues), 149.4 bits, see alignment E=6.7e-48

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a4814)

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WGI1 at UniProt or InterPro

Protein Sequence (467 amino acids)

>AO353_14395 poly(A) polymerase (Pseudomonas fluorescens FW300-N2E3)
MLKKLFQSFRSPLRRTQHIRSTPEVLNSSQHSLQRAQFSRYAVNIVERLQSAGYQAYLVG
GCVRDMLLNITPKDFDVATSATPEQVRAEFRNARIIGRRFKLVHIHFGREIIEVATFRAN
HPQNDEEEDSNQSSRNESGRILRDNVYGTLEEDAQRRDFTINALYYDPVSERILDYANGV
HDIRNHLIRLIGDPTQRYQEDPVRMLRAVRFAAKLDFGIEKHSATPIRNLAPMLREIPSA
RLFEEVLKLFLSGHAADTFEMLVDLQLFDPLFPASAEALEHNPTYTHTLISEALINTDLR
IKQNKPVTPAFLFAALLWPALPARVLRLQDRGMPPIPAMQEAAHELISEQCQRIAIPKRF
TMPIREIWDMQERLPRRSGKRADLLLDNPRFRAGYDFLLLRESAGEQTNGLGEWWTDYQD
ANESERRDMIRDLSGKDDGASGAPRKRRRSGGAKRKRAAGVPSASGE