Protein Info for AO353_14320 in Pseudomonas fluorescens FW300-N2E3

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06750: A24_N_bact
  • amino acids 20 to 126 (107 residues), 118.3 bits, E=1.2e-38
• PF01478: Peptidase_A24
  • amino acids 136 to 244 (109 residues), 95.7 bits, E=2.1e-31

Best Hits

Swiss-Prot: 71% identical to LEP4_PSEST: Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD) from Pseudomonas stutzeri

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 82% identity to pfo:Pfl01_4822)

MetaCyc: 70% identical to prepilin leader peptidase/N-methyltransferase (Pseudomonas aeruginosa)
Prepilin peptidase. [EC: 3.4.23.43]; 2.1.1.- [EC: 3.4.23.43]

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

See A0A0N9VQ12 at UniProt or InterPro

Protein Sequence (290 amino acids)

>AO353_14320 methyltransferase (Pseudomonas fluorescens FW300-N2E3)
MPLSEFMAGYPLAFVVTALVLGLVIGSFLNVVVWRLPKMLEGDWRQQALDVLGLPPEAPG
PTYNLMLPHSHCPQCAHRIRAWENIPLLSYLALRGRCSNCKAPISARYPLTELACGVLSA
FVAWHFGFGWTAAWVLVLSWGLLAMCLIDADHQLLPDVLVLPLLWLGLIVNSFELFVPLQ
AAMWGAVAGYLLLWSVYWLFKLITGKEGIGHGDFKLLALLGAWGGWQILPLTVLLSSLVG
AVGGVILLRLKDTNTSTPIPFGPYLAIAGWIALLWGGQITGFYWQFVGFK