Protein Info for AO353_14205 in Pseudomonas fluorescens FW300-N2E3

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 119 (17 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details PF00512: HisKA" amino acids 310 to 374 (65 residues), 57.7 bits, see alignment E=9.8e-20 PF02518: HATPase_c" amino acids 417 to 522 (106 residues), 69.3 bits, see alignment E=3.9e-23

Best Hits

KEGG orthology group: K02668, two-component system, NtrC family, sensor histidine kinase PilS [EC: 2.7.13.3] (inferred from 81% identity to pfo:Pfl01_4839)

Predicted SEED Role

"Two-component sensor PilS" in subsystem Type IV pilus

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VUE9 at UniProt or InterPro

Protein Sequence (529 amino acids)

>AO353_14205 histidine kinase (Pseudomonas fluorescens FW300-N2E3)
VIAEISSPGDKQAQRLLRLYHLYRLSIGLLLVLLISSNMDNQLLEFTNDDLLRNGSWLYL
ILNILLVVFAGNPRQPAQIFGLTLVDILLLSVLFYAAGGVPSAIGNLLIVSVAIGNTLLR
RRIGLLLAAVAAIGIISLTFSLSGSHPTGANHYLQAGTLGALCFAAALLVQGLTRQLEVS
ESLAQQRASEVVSLEALNALILQRMRTGILVLDSERRVQLANHSALSLFGQTHLDGQLID
DYSTALVERLQLWFNNPTLRPQSLKVARTGLELQPSFIALGLNEQRQTLVFLEDLAQVAQ
QAQQLKLAALGRLTAGIAHEIRNPLGAISHAAQLLNESEELIGADRRLTQIIQDHSQRMN
RVIENVLQLSRRQQVVPQRLDLKQWLEQFVCTVREGATDRQQIHLNAGPGPFTTLIDPDQ
LTQVLDNLLRNAWRHSALAHEQAEVWLTLFIDPDSQLPTLDVLDNGPGVSAEQQAHLFEP
FFTTSSQGTGLGLYLSRELCESNQARLDFKPRQGGGCFRITFAHGRKQS