Protein Info for AO353_14200 in Pseudomonas fluorescens FW300-N2E3

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF00072: Response_reg" amino acids 9 to 118 (110 residues), 98.5 bits, see alignment E=5.5e-32 PF14532: Sigma54_activ_2" amino acids 139 to 309 (171 residues), 95.9 bits, see alignment E=5e-31 PF00158: Sigma54_activat" amino acids 139 to 304 (166 residues), 225.6 bits, see alignment E=6.2e-71 PF02954: HTH_8" amino acids 405 to 445 (41 residues), 54.6 bits, see alignment 1.4e-18

Best Hits

Swiss-Prot: 79% identical to PILR_PSEAE: Type 4 fimbriae expression regulatory protein PilR (pilR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02667, two-component system, NtrC family, response regulator PilR (inferred from 84% identity to pfo:Pfl01_4840)

Predicted SEED Role

"Type IV fimbriae expression regulatory protein PilR" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WGF6 at UniProt or InterPro

Protein Sequence (448 amino acids)

>AO353_14200 transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
LKTSPRQKVLIVDDEPDIRELLEITLGRMKLDTLSARNVGEARSLLAQERFDLCLTDMRL
PDGTGLELVQHIQLTHPYVPVAMITAYGSLDTAINALKAGAFDFLTKPVNLTRLRELVVS
ALRLPVAGDAASAIDRRLLGDSVPMRNLRTQIDKLARSQAPVYISGESGSGKELVARLIH
EQGPRSGQPFVPVNCGAIPSELMESEFFGHRKGSFSGAIEDKPGLFQAANGGTLFLDEVA
DLPLAMQVKLLRAIQEKAVRSIGGQQEAIINVRILCATHRDLDAEVAAGRFRQDLYYRLN
VIELRVPPLRERRDDIELLASHVLKRLAAGSGLPAVHLQPQALDALKHYRFPGNVRELEN
MLERAYTLCENKQIEASDLRLTDGNCSADTGLPDLTKIDNLEQYLENVERKLILQALEET
RWNRTAAAQRLNLSFRSMRYRLKKLGLD