Protein Info for AO353_14115 in Pseudomonas fluorescens FW300-N2E3

Annotation: gamma-glutamyl kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01027: glutamate 5-kinase
  • amino acids 10 to 370 (361 residues), 433.5 bits, E=3.3e-134
• PF00696: AA_kinase
  • amino acids 10 to 238 (229 residues), 163.5 bits, E=7.4e-52
• PF01472: PUA
  • amino acids 281 to 351 (71 residues), 75.3 bits, E=3e-25

Best Hits

Swiss-Prot: 97% identical to PROB_PSEPF: Glutamate 5-kinase (proB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 96% identity to pfl:PFL_5326)

MetaCyc: 44% identical to glutamate 5-kinase (Escherichia coli K-12 substr. MG1655)
Glutamate 5-kinase. [EC: 2.7.2.11]

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

• L-citrulline biosynthesis (7/8 steps found)
• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (3/3 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-N^δ-acetylornithine biosynthesis (5/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

See A0A0N9WKA8 at UniProt or InterPro

Protein Sequence (372 amino acids)

>AO353_14115 gamma-glutamyl kinase (Pseudomonas fluorescens FW300-N2E3)
MRSKVTGAQRWVVKIGSALLTADGKGLDRAAMSVWVEQMVALHEAGVELVLVSSGAVAAG
MSRLGWTARPSAMHELQAAAAIGQMGLVQAWESSFAEHGRHTAQILLTHDDLSDRKRYLN
ARSTLRALVDLKVIPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPDAKLIYEARADDPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTIIVGG
RLERVLDRLKAGERIGTLLSPERGLLAARKQWLAGHLQTRGTLVLDEGAVTALSRGNKSL
LPVGVKLVQGSFRRGEMVVCVAPDGREIARGLANYSALEAQKIIGQSSEAIVGLLGYMAE
PELVHRDNLILV