Protein Info for AO353_14105 in Pseudomonas fluorescens FW300-N2E3

Annotation: 50S ribosomal protein L27

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 85 TIGR00062: ribosomal protein bL27" amino acids 1 to 83 (83 residues), 128.7 bits, see alignment E=3.3e-42 PF01016: Ribosomal_L27" amino acids 2 to 82 (81 residues), 126.7 bits, see alignment E=1.5e-41

Best Hits

Swiss-Prot: 100% identical to RL27_PSEFS: 50S ribosomal protein L27 (rpmA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02899, large subunit ribosomal protein L27 (inferred from 98% identity to pfv:Psefu_0731)

MetaCyc: 71% identical to 50S ribosomal subunit protein L27 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L27p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0B7DE80 at UniProt or InterPro

Protein Sequence (85 amino acids)

>AO353_14105 50S ribosomal protein L27 (Pseudomonas fluorescens FW300-N2E3)
MAHKKAGGSTRNGRDSEAKRLGVKMYGGQKIIPGNIIVRQRGTQFHAGYGVGMGKDHTLF
AKIEGVIKFEVKGAFNRRYVSVVAA