Protein Info for AO353_14040 in Pseudomonas fluorescens FW300-N2E3

Annotation: chorismate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01817: CM_2
  • amino acids 12 to 88 (77 residues), 74.2 bits, E=4.4e-25

Best Hits

KEGG orthology group: K04782, isochorismate pyruvate-lyase [EC: 4.1.3.-] (inferred from 72% identity to hna:Hneap_2059)

Predicted SEED Role

"Isochorismate pyruvate-lyase (EC 4.-.-.-)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 4.-.-.-)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Biosynthesis of type II polyketide backbone
• Photosynthesis - antenna proteins
• Porphyrin and chlorophyll metabolism
• Pyruvate metabolism
• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 4.-.-.- or 4.1.3.-

Sequence Analysis Tools

See A0A0N9WVL1 at UniProt or InterPro

Protein Sequence (101 amino acids)

>AO353_14040 chorismate mutase (Pseudomonas fluorescens FW300-N2E3)
MDANCRSLEEARENIDRLDRQIVSLLAARGAYVSQAARFKKDSDAVKAPQRVEQVIAKVR
ALAEEVGANPQVIEQVYRAMIAAFIEQELAEHAHLATTTMD