Protein Info for AO353_13905 in Pseudomonas fluorescens FW300-N2E3

Annotation: tRNA (uracil-5-)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 TIGR02143: tRNA (uracil(54)-C(5))-methyltransferase" amino acids 8 to 359 (352 residues), 588.6 bits, see alignment E=2e-181 PF05958: tRNA_U5-meth_tr" amino acids 8 to 359 (352 residues), 543.3 bits, see alignment E=2.7e-167 PF13649: Methyltransf_25" amino acids 208 to 266 (59 residues), 27.8 bits, see alignment E=3.4e-10

Best Hits

Swiss-Prot: 94% identical to TRMA_PSEPF: tRNA/tmRNA (uracil-C(5))-methyltransferase (trmA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00557, tRNA (uracil-5-)-methyltransferase [EC: 2.1.1.35] (inferred from 96% identity to pba:PSEBR_a4906)

MetaCyc: 48% identical to tRNA m5U54 methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA (uracil-5-)-methyltransferase. [EC: 2.1.1.35]

Predicted SEED Role

"tRNA (Uracil54-C5-)-methyltransferase (EC 2.1.1.35)" (EC 2.1.1.35)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.35

Use Curated BLAST to search for 2.1.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WJ20 at UniProt or InterPro

Protein Sequence (359 amino acids)

>AO353_13905 tRNA (uracil-5-)-methyltransferase (Pseudomonas fluorescens FW300-N2E3)
MTFDSQAYTAQLEEKATRLRDLLAPFDAPELAVFDSPLANFRLRAEFRLWREAGERHYAM
FSQEDKRTPILIEEFPIASQRINQLMPQLKAAWQASAALSHKLFQVEFLTTLAGDAMITL
CYHRPLDEHWHAAASKLAADLNVSVIGRSKGKREVIGHDYVVEKLEVGGRTFSYRQPEGA
FTQPNGTVNQKMLNWAYDALGDRCDDLLELYCGNGNFTLPLATRVRKVLATEISKTSVNA
ALSNLSENAVDNVTLVRLSAEELTEALNEVRPFRRLHGIDLKSYEFGSVFVDPPRAGMDP
DTCELTRRFENILYISCNPETLAANIAQLHDTHRITRCAMFDQFPWTHHMESGVLLTRR