Protein Info for AO353_13605 in Pseudomonas fluorescens FW300-N2E3

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 TIGR02435: precorrin-3B synthase" amino acids 6 to 394 (389 residues), 407.9 bits, see alignment E=2.2e-126 PF03460: NIR_SIR_ferr" amino acids 20 to 81 (62 residues), 44.9 bits, see alignment E=7.8e-16 amino acids 253 to 319 (67 residues), 65 bits, see alignment E=4.1e-22 PF01077: NIR_SIR" amino acids 90 to 230 (141 residues), 68.4 bits, see alignment E=5.1e-23

Best Hits

KEGG orthology group: K02229, precorrin-3B synthase [EC: 1.14.13.83] (inferred from 71% identity to pfl:PFL_0657)

Predicted SEED Role

"Cobalamin biosynthesis protein CobG" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X2T4 at UniProt or InterPro

Protein Sequence (435 amino acids)

>AO353_13605 oxidoreductase (Pseudomonas fluorescens FW300-N2E3)
LHTALRPSACPGLLRIVQASDGGICRIKLNGGSISSAQAMAVAEAAERYAGGVIEATNRA
NLQIRGIGSEHRPLIDSLLAAGLGPKTAAGDDVRNLMLSPGAGIDRHMLFDTRPLAEQIL
ATLQSHERFHQLSAKFAVQLDGGEALAMLEHPHDLWLSAVERNGEQWLAFGLAGCPTDTP
AGAVLRNDGHTLVVAVLELFLDLARPDQTRMRQVLAERSLASVVQALAERVPLTPISDWQ
RPESRPGLHIGTYPQRQEDLVYVGAVPPLGRLDASMLKGAASLAEAFGDGSLRVTPWQSL
LLPNIRPQDAPALSEGMQALGFLVSADQALAHLVACTGSAGCGKGLADTKGDALQLSTQL
QSRGDRVHVHLSGCPRSCAAAHIAPVTLLAVSPGHYDLYFRNAGQPGFGALQARNLTIEA
AGAALDARPRSPLDA