Protein Info for AO353_13595 in Pseudomonas fluorescens FW300-N2E3

Annotation: cobalt-precorrin-6A synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01888: CbiD
  • amino acids 12 to 271 (260 residues), 295.8 bits, E=1.2e-92
• TIGR00312: cobalamin biosynthesis protein CbiD
  • amino acids 19 to 318 (300 residues), 197.7 bits, E=1.2e-62

Best Hits

Swiss-Prot: 91% identical to CBID_PSEPF: Cobalt-precorrin-5B C(1)-methyltransferase (cbiD) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02188, cobalamin biosynthesis protein CbiD (inferred from 91% identity to pba:PSEBR_a614)

Predicted SEED Role

"Cobalt-precorrin-6 synthase, anaerobic" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (13/15 steps found)

Sequence Analysis Tools

See A0A0N9VU74 at UniProt or InterPro

Protein Sequence (365 amino acids)

>AO353_13595 cobalt-precorrin-6A synthase (Pseudomonas fluorescens FW300-N2E3)
MRDETAEQPAPLRSGLTTGSCATATSLAAARLLLGAVSSDAVEIVLPKGKQVQMRLEFCR
LTADGAEAGTIKDAGDDPDVTHGALLYSQVRLVAEPGIRFCAGKGVGTVTRPGLILSVGE
PAINPVPRKMISDHLLLLAQEFSYGGGFEVTVNVENGEALALKTMNPRLGILGGLSILGT
SGIVRPFSCAAYIASIHQGIDVAKTNGYLHIAACTGNASEDTMRRVYDLPEIALIEMGDF
VGAVLKHLRKVPVDKLSICGGFGKISKLAAGHMDLHSRHSSIDLPQLAEWAADVGADAAL
QQGIREANTSQQALAMASAAGIALGDAVCQHALDFARSVVPRQVQIEVFAIDRQGGIVGH
AGAFQ