Protein Info for AO353_13580 in Pseudomonas fluorescens FW300-N2E3

Annotation: copper resistance protein CopZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF04314: PCuAC" amino acids 30 to 140 (111 residues), 122.4 bits, see alignment E=4e-40

Best Hits

KEGG orthology group: K09796, hypothetical protein (inferred from 83% identity to pfo:Pfl01_0598)

Predicted SEED Role

"Copper metallochaperone, bacterial analog of Cox17 protein" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W682 at UniProt or InterPro

Protein Sequence (159 amino acids)

>AO353_13580 copper resistance protein CopZ (Pseudomonas fluorescens FW300-N2E3)
MLKKLIVLAALLLPACFANAHEYKAGELEIAHPWSQELPPNAPTVAAYFVIHNNGKTADR
LLSVASPIAGIAELHEHVMQGDLMKMQQVPSVEIPAGDDITFAPMAYHVMLLELKDRSLL
RDGKRFPLTLHFEKSGDVTVEVAVQKQPPAGSEAHMHAQ