Protein Info for AO353_13540 in Pseudomonas fluorescens FW300-N2E3

Annotation: urea ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 211 to 234 (24 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 348 to 367 (20 residues), see Phobius details amino acids 400 to 418 (19 residues), see Phobius details amino acids 431 to 457 (27 residues), see Phobius details amino acids 465 to 484 (20 residues), see Phobius details TIGR03409: urea ABC transporter, permease protein UrtB" amino acids 205 to 496 (292 residues), 436.9 bits, see alignment E=2.2e-135 PF02653: BPD_transp_2" amino acids 208 to 482 (275 residues), 147.3 bits, see alignment E=5.1e-47

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 93% identity to pfo:Pfl01_0589)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtB" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WI69 at UniProt or InterPro

Protein Sequence (499 amino acids)

>AO353_13540 urea ABC transporter permease (Pseudomonas fluorescens FW300-N2E3)
MSLYRLFLAIAFVLLPMVAHAGDAEDFVAANPVQQAKLLETWAAQPDPARIELINALQQG
QLSVDGEVRILRLNNRLRGLIDTALASHQLLAADTKVRLSAAQQLQKSAKPAQLKFLDQQ
LAGEKDPSVHAALSLALANLQLVDADPAVRLAAVRLLGETGDPLARTRLEGLLQPGVEAD
ATVHTAAETSLAQVKRKLLIGELLGQAFSGMSLGSILLLAALGLAITFGLLGVINMAHGE
MLMLGAYSTYVVQLLFQRFAPQAIEFYPLIALPVAFFVTAGIGMALERTVIRHLYGRPLE
TLLATWGISLMLIQLVRLLFGAQNVEVANPAWLSGGIQVLPNLVLPYNRIVIIAFALFVV
VLTWLLLNKTRLGLNVRAVTQNRNMAACCGVPTGRVDMLAFGLGSGIAGLGGVALSQVGN
VGPDLGQSYIIDSFLVVVLGGVGQLAGSVLAAFGLGIANKILEPQIGAVLGKILILALII
LFIQKRPQGLFALKGRVID