Protein Info for AO353_13400 in Pseudomonas fluorescens FW300-N2E3

Annotation: urease accessory protein UreG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00101: urease accessory protein UreG
  • amino acids 6 to 201 (196 residues), 335.6 bits, E=5.1e-105
• PF02492: cobW
  • amino acids 8 to 178 (171 residues), 126.9 bits, E=7.2e-41

Best Hits

Swiss-Prot: 98% identical to UREG_PSEPF: Urease accessory protein UreG (ureG) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03189, urease accessory protein (inferred from 97% identity to psb:Psyr_4453)

MetaCyc: 64% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)

Sequence Analysis Tools

See A0A0N9WG48 at UniProt or InterPro

Protein Sequence (204 amino acids)

>AO353_13400 urease accessory protein UreG (Pseudomonas fluorescens FW300-N2E3)
MNTQPLRVGIGGPVGSGKTALTLALCLALRDRYNLAVVTNDIYTREDADFLVRNEALAPE
RIIGVETGGCPHTAIREDASINLEAVDQLNRRFPGLDLILVESGGDNLSATFSPELSDLT
IYVIDVSAGDKLPRKGGPGICKSDLLVINKIDLAPLVGASLSMMDSDTQRMRGGKPFVFS
NQKTGQGLEEIIAFIERQGLLTAA