Protein Info for AO353_13380 in Pseudomonas fluorescens FW300-N2E3
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 61% identical to ISFD2_CHRSD: Sulfoacetaldehyde reductase 2 (isfD2) from Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 97% identity to pfo:Pfl01_0557)MetaCyc: 62% identical to sulfoacetaldehyde reductase (NADPH) (Klebsiella oxytoca TauN1)
RXN-12148 [EC: 1.1.1.313]
Predicted SEED Role
"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization
MetaCyc Pathways
- sulfoacetaldehyde degradation III (1/1 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.- or 1.1.1.313
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N9WK21 at UniProt or InterPro
Protein Sequence (256 amino acids)
>AO353_13380 hypothetical protein (Pseudomonas fluorescens FW300-N2E3) MSNTLFITGATSGFGEACARRFAEAGWKLVLTGRREERLNALCAELSKQTEVHGLVLDVR DRKAMEEAIANLPPSFAKLRGLINNAGLALGVDPAPKCDLDDWETMVDTNIKGLMYSTRL LLPRLIAHGRGAGIINLGSIAGNYPYPGSHVYGATKAFVKQFSLNLRCDLQGTGVRVSNI EPGLCESEFSLVRFGGDQARYDATYSGAEPIQPQDIAETIFWVLNAPAHININRLELMPV SQTWGGFAIDRSGGKA