Protein Info for AO353_13285 in Pseudomonas fluorescens FW300-N2E3

Annotation: molybdopterin oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 828 transmembrane" amino acids 635 to 651 (17 residues), see Phobius details amino acids 672 to 689 (18 residues), see Phobius details amino acids 711 to 725 (15 residues), see Phobius details PF14403: CP_ATPgrasp_2" amino acids 81 to 459 (379 residues), 521.9 bits, see alignment E=1.4e-160 PF04174: CP_ATPgrasp_1" amino acids 81 to 412 (332 residues), 368.3 bits, see alignment E=4.9e-114 PF04168: Alpha-E" amino acids 509 to 815 (307 residues), 210.9 bits, see alignment E=5.4e-66

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfo:Pfl01_0542)

Predicted SEED Role

"Protein containing domains DUF404, DUF407, DUF403"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VU34 at UniProt or InterPro

Protein Sequence (828 amino acids)

>AO353_13285 molybdopterin oxidoreductase (Pseudomonas fluorescens FW300-N2E3)
MPDLLDRYPFTPGTYHELLDDSGAVRPHWRRLFDQLQRSTPAQLLQRQALLARQIQENGV
TYNVYADPKGADRPWELDLLPHVMAADEWQQLSAGIAQRARLLNAVLADLYGPQRLIAEG
LLPAELVFGHNNFLWPCQGIQPPDGAFLHLYAVDLARTPDGRWWVTADRTQAPSGAGYAL
ENRTIVSRAFPELYRDLQVQHLAGFFRTLQETLARQAPSADEVPLVVLLTPGRFNESYFE
HLYLARQLGYPLVEGGDLTVRDATVYLKTLSGLRRVHAIMRRLDDDFCDPLELRTDSALG
VPGLLDAVRQGRVLVANALGSGVLESPGLLGFLPKINQFLFGEELILPSIATWWCGEPPV
LAQALEKMPELLIKPAFPSQSFASVLGRDLSEKQRQDLSERMQARPYAYVAQELAQLSQA
PIWQAEDGQLQHRAIGMRVYAVASQDGYRVLPGGLTRVAAEPDAEVVSMQRGGASKDTWV
LGERAPIGEQWKTQRTLGVHDLVRRDPYLPSRVVENLFWFGRYCERCDDSARLLRIMLTR
YVDGDDPQALQAAVDLGESLLLLPDEGELPERLLTALCGDDWAFSLRSNLQRLQWAASQV
RGKLSRENWQALVELQRDAMELETEEPDFGERLDFLNRLVMSLAALSGFALDDMTRDEGW
RFLMIGRRIERLQFLGSSLAAFLRGAGAFDQAGLEWLLELGNSSITYRSRYLAVAQLIPV
LDVLLLDEQNPHGVLFQLKLVARTLKRLNDDFGLPRDLALPSLVERLARFDLGCLENGLF
GEASVRAALSGLADLLQEIADVSNQVSDRLALRHFAHVDDVSQRTVSV