Protein Info for AO353_13015 in Pseudomonas fluorescens FW300-N2E3

Annotation: nitrate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 237 to 262 (26 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 318 to 335 (18 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 374 to 394 (21 residues), see Phobius details amino acids 403 to 422 (20 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 14 to 374 (361 residues), 85.9 bits, see alignment E=1.3e-28 TIGR02358: putative hydroxymethylpyrimidine transporter CytX" amino acids 24 to 416 (393 residues), 432.5 bits, see alignment E=8.4e-134

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU0493)

Predicted SEED Role

"Predicted hydroxymethylpyrimidine transporter CytX" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WJW4 at UniProt or InterPro

Protein Sequence (430 amino acids)

>AO353_13015 nitrate reductase (Pseudomonas fluorescens FW300-N2E3)
LSIQPSTYSPDHAVPLAQRVFGARDLFSLWFSLGIGLMVLQTGALLAPGLGLSGSLLAIF
LGTLVGVLLLACVGVIGSDTGLSAMAALKLSLGTRGASLPALLNLLQLIGWGSFEIIVMR
DAASLLGARAFSDASLMANPLLWTLAFGALATLLAVSGPLTFVRQILRKWGIWLLLAACI
WLTWNLFAKADLAALWAQAGDGSMPFAVGFDIAIAMPLSWLPLIADYSRFGKRAKSVFGG
TALGFFIGNFWLMSLGVAYTLAFAPSGEVNALLLALAGAGLGIPLLLILLDESENAFADI
HSAAVSSGILLRMKVEHLALAIGVICTLIACLAPLAQYQNFLLLIGSVFAPLFGVVLVDH
FILRKRSAQIASAALRWPALLAWLGGVSTYHLLANLYPEVGATLPSLVVAGLMQLLLGRV
FSYAPAPAQA