Protein Info for AO353_12965 in Pseudomonas fluorescens FW300-N2E3

Annotation: adenylylsulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 98 to 117 (20 residues), see Phobius details TIGR00455: adenylyl-sulfate kinase" amino acids 22 to 199 (178 residues), 228.5 bits, see alignment E=2.4e-72 PF06414: Zeta_toxin" amino acids 30 to 78 (49 residues), 22.4 bits, see alignment E=1.1e-08 PF01583: APS_kinase" amino acids 33 to 186 (154 residues), 217 bits, see alignment E=2e-68 PF13671: AAA_33" amino acids 38 to 148 (111 residues), 40.4 bits, see alignment E=5.6e-14

Best Hits

Swiss-Prot: 56% identical to CYSC_SHESM: Adenylyl-sulfate kinase (cysC) from Shewanella sp. (strain MR-4)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 75% identity to pfl:PFL_0529)

MetaCyc: 53% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4) / Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25, EC 2.7.7.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.25, 2.7.7.4

Use Curated BLAST to search for 2.7.1.25 or 2.7.7.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VPD8 at UniProt or InterPro

Protein Sequence (203 amino acids)

>AO353_12965 adenylylsulfate kinase (Pseudomonas fluorescens FW300-N2E3)
MNESPLIAAHSSNIRPFALSLSPSARAALKHQQPCCLWLTGLSGAGKSTLANALELQLNE
QGRHTFVLDGDNLRNGLCNDLGMGAAARKENIRRIAEVARLMVDAGLIVIVSAISPFQAD
RASARALFRTDEFLEVYVSTPFDICARRDPKGLYQAALQGRIKDFTGLDSPYEAPRQADC
EINTDEVVLADAVQHVLAVLLKK