Protein Info for AO353_12940 in Pseudomonas fluorescens FW300-N2E3

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF20706: GT4-conflict" amino acids 186 to 300 (115 residues), 28.7 bits, see alignment E=1e-10 PF00534: Glycos_transf_1" amino acids 192 to 331 (140 residues), 92.1 bits, see alignment E=4.7e-30 PF13692: Glyco_trans_1_4" amino acids 196 to 331 (136 residues), 84.9 bits, see alignment E=1e-27

Best Hits

KEGG orthology group: None (inferred from 52% identity to ppg:PputGB1_4987)

Predicted SEED Role

"Glycosyl transferase in large core OS assembly cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WHW7 at UniProt or InterPro

Protein Sequence (367 amino acids)

>AO353_12940 glycosyl transferase (Pseudomonas fluorescens FW300-N2E3)
MSILNVMWSGGAAYASVHKVHLQILAQVEPATPINTWLLRGSARGCVAEIGETREWHLSS
NQLKGRRFWKLLTLWMQARFYYALNQSDVRVLLLDGLGTARALLPVLKKLPQLRAVVLFH
GATRISAADRKLFSQLPASQLTLAAVSQTLASALEADLQIPVVTLRSALDPLAFRSRLLS
REQARARLQLPVDNTPVVGAVGRLVGKKGFACLIEAFAKTLTQHPQLRLVIIGEGQARAA
LEARVNQLGLRDKVLLPGNLEDAATLFRAFDWIAIPSLEEGLGLILQEAVMAGVPVLSSD
LAVFREQLAGAGRYATPEDVTAWSEALIQALGVASESVAAAQFTVLSPDDAWLEFSQVAR
KLLSCAK