Protein Info for AO353_12920 in Pseudomonas fluorescens FW300-N2E3

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 101 to 119 (19 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 31 to 173 (143 residues), 32.2 bits, see alignment E=2.2e-11 PF00534: Glycos_transf_1" amino acids 182 to 332 (151 residues), 108.1 bits, see alignment E=7.3e-35 PF13692: Glyco_trans_1_4" amino acids 197 to 331 (135 residues), 100.3 bits, see alignment E=2.4e-32 PF20706: GT4-conflict" amino acids 266 to 327 (62 residues), 26.6 bits, see alignment E=5.9e-10

Best Hits

KEGG orthology group: None (inferred from 85% identity to pfl:PFL_0519)

Predicted SEED Role

"Glycosyl transferase in large core OS assembly cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WFX9 at UniProt or InterPro

Protein Sequence (376 amino acids)

>AO353_12920 glycosyl transferase (Pseudomonas fluorescens FW300-N2E3)
MTRSAERHVLQFCHGYDGPFLDCARQYASLFAGSGYRVTTVFLTGVADADVAAGCASDEV
LFMEYSSKAIRGLKLSAIADLRKIAQSRNFSFCIAHRFKPIYIALLATPLPVIGVHHAFG
DYRRRTRKLFAHIFRKRLSLLGVSDAVRDDMRRCLPKWPAARIQTLYNRIDVDALQATQV
SFDEARDALGLSPDAWVIGNVGRLHPDKDQATLLRGFAQALPRLPVGSQLAILGSGRLEQ
RLKDLAREIGIGDRVLFLGQVPEARRYFRAFDVFALSSDHEPFGMVLLEAMAAGVPLLAT
ACGGAAEVVEGVGILFPQGDVEHLALGLQHLAVMNQHEHQVCAEMMLDRLRERFSDRAVH
ETFWRLPHVLELTARA