Protein Info for AO353_12640 in Pseudomonas fluorescens FW300-N2E3

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 206 to 246 (41 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details amino acids 322 to 339 (18 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 85% identity to pfl:PFL_0468)

Predicted SEED Role

"FIG064705: cation/hydrogen antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WV04 at UniProt or InterPro

Protein Sequence (386 amino acids)

>AO353_12640 sodium:proton antiporter (Pseudomonas fluorescens FW300-N2E3)
MMTMLFWLLALALFAVATRVGRHFGLIPIVSQLLLATFGLPLLMYFWIEPYWQLSGAELV
SPGWLKNLYSLSFALLLGHILSDVIDLKLDRQSLKIALPSFGIPFACGLATAIWLLPDQP
WLSSLAVGLLFAITAIPVLYLYLRHINYPPAATRRLVQTAILIDLTCWSLFAFAQGSLHL
SSLLLPLAGACLPLLLRVLGLRQPLLHSLGFFALLVVAEHFKLNALIFGIGYLLCMAALK
LPLVLPLSAAWMSRLQNGIAIPLILTFGIVQINVHSAMDSLSWMQLGALLVFPIASKLLG
NWLGLGWAGTSFVGANRWRESLLLNIRGLSEIVFLNLLLQQQLISPALYFALMLMGLIAT
LLPALAGVHRIPSPLAAPARSSSANS