Protein Info for AO353_12565 in Pseudomonas fluorescens FW300-N2E3

Annotation: type II secretion system protein GspH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details PF07963: N_methyl" amino acids 4 to 27 (24 residues), 35.7 bits, see alignment 4.2e-13 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 5 to 27 (23 residues), 31.9 bits, see alignment 7.8e-12 TIGR01708: type II secretion system protein H" amino acids 6 to 139 (134 residues), 51 bits, see alignment E=1.4e-17 PF12019: GspH" amino acids 42 to 147 (106 residues), 32.7 bits, see alignment E=9.4e-12

Best Hits

KEGG orthology group: K02457, general secretion pathway protein H (inferred from 48% identity to pap:PSPA7_1412)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VTU2 at UniProt or InterPro

Protein Sequence (155 amino acids)

>AO353_12565 type II secretion system protein GspH (Pseudomonas fluorescens FW300-N2E3)
MRQACRGFTLLELMVVMVLIGVLLGMAGLAIGNHPARLARQEANGLIQLLQALREQAVLE
GREYGLRLEPEGYQVLGLYGQDWRPAGRAYRLPEGLQLRLEQSGQISTLTGRPGQPHLVL
LSSDESTAFTLRLQAGQQSLISLSSDGLNEAALDE