Protein Info for AO353_12510 in Pseudomonas fluorescens FW300-N2E3

Annotation: cell division protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 transmembrane" amino acids 263 to 281 (19 residues), see Phobius details PF13604: AAA_30" amino acids 43 to 151 (109 residues), 28.6 bits, see alignment E=1.7e-10 PF13401: AAA_22" amino acids 48 to 167 (120 residues), 52.3 bits, see alignment E=1.1e-17 PF05036: SPOR" amino acids 447 to 519 (73 residues), 44.6 bits, see alignment E=2.3e-15

Best Hits

KEGG orthology group: K03112, DamX protein (inferred from 90% identity to pfl:PFL_0452)

Predicted SEED Role

"DamX, an inner membrane protein involved in bile resistance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WIE0 at UniProt or InterPro

Protein Sequence (533 amino acids)

>AO353_12510 cell division protein (Pseudomonas fluorescens FW300-N2E3)
MTSLHADEAFLGHYQLSHDPFAPRVPGFKFFPAQRKPVLGQLHHLARYSQLLLVVTGPQG
SGKTLLRQALVASTNKQSVQSVVVSARGAGDAAGVLRQVAQALNVAQAEVGAILKQVVQL
ALTGQEVYLLVDDAEQLDESALEALLALAAGAPEGRPHVFLFGESSLIAELEQLSTEEER
FHVIELQPYAEEETREYLAQRLEGAGQGIELFSANQISEIHESSDGWPGNINQVARDAMI
EAMIASRSAVKRPSMGFNMPKKHVLAISAVVVVAVAAAWLMPGRSKAPATGAPANEQAQL
PLGTPKPNGGAPSVEFAGNTQPMPLPLVGQSQPVMRGPLAEAAGGITEGDDGVPVEGSSA
KPPTVTTTAPPAGIPAGPTPAPAPAPAAKPTPAPTQVATAKPAPAPAAKPAPVAKPTPVA
KPVEKPVEKPATVAKAATGGTWYAGQAPGNYVVQILGTSSEAAAQNFVKEQGGEYRYFKK
VLNGKPLYVITYGSFANRDAAVTAIKALPAKVQAGKPWPRSVASVQQELATAR