Protein Info for AO353_12445 in Pseudomonas fluorescens FW300-N2E3

Annotation: primosomal protein N'

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 739 PF17764: PriA_3primeBD" amino acids 8 to 105 (98 residues), 91.6 bits, see alignment E=7e-30 PF04851: ResIII" amino acids 201 to 363 (163 residues), 62.4 bits, see alignment E=1.6e-20 PF00270: DEAD" amino acids 205 to 368 (164 residues), 78.8 bits, see alignment E=1.2e-25 TIGR00595: primosomal protein N'" amino acids 225 to 736 (512 residues), 610.1 bits, see alignment E=1.6e-187 PF18319: PriA_CRR" amino acids 449 to 475 (27 residues), 43.9 bits, see alignment (E = 5.4e-15) PF00271: Helicase_C" amino acids 509 to 592 (84 residues), 26.4 bits, see alignment E=2.1e-09 PF18074: PriA_C" amino acids 636 to 735 (100 residues), 87.6 bits, see alignment E=2.4e-28

Best Hits

KEGG orthology group: K04066, primosomal protein N' (replication factor Y) (superfamily II helicase) [EC: 3.6.4.-] (inferred from 96% identity to pba:PSEBR_a417)

Predicted SEED Role

"Helicase PriA essential for oriC/DnaA-independent DNA replication" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA-replication

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VTS7 at UniProt or InterPro

Protein Sequence (739 amino acids)

>AO353_12445 primosomal protein N' (Pseudomonas fluorescens FW300-N2E3)
VPDAILRLALPSPLRRLFDYRAPAGVLRAHLHPGMRLRVPFGRREMIGILVEVTSHSEVP
ADKLKPALALLDATPPLPASLFKLCLWTSQYYQHSLGDTLSWALPVLLRQGELAEARQER
FWSITPGAKLDDPRIARAPRQREALATLAQHPHGVAHQLLSKLMLSKDSLDLLLAKELVQ
VDIRKHAPGERHEHWLAQPELPLNPEQRAAYEAIRAGFDSFHAFLLAGVTGSGKTEVYLQ
LIRETLEAGKQALVLIPEINLGPQTLARFEQRFNARIALVHSAVNDRERLESWLAARDGE
ADIIIGTRSALFTPMKNPGLIIIDEEHDGSYKQQEGLRYHARDLALVRARQENIPIVLGS
ATPSLESLHNAYTGRYGLLRLNERAGGAKQPRFLRLDVKSRPLDSGISGPMQQAIGQTLA
AGQQVLVFLNRRGFAPTLLCHDCGWMSECQRCDARMTVHQRSGELRCHHCGYVERVPRHC
PKCGKVDLRPVGAGTERAEERLGILFPDYPVLRVDRDSTSRKDAMNQLFATIQKGQPCIL
VGTQMLAKGHHFPRVTLVSILDADGGLFSGDFRASERMAQLIVQVAGRAGRAEEPGKVII
QTHLADHPLLVQLTEQGYFAFAEQALSERRSAGLPPFAHLALLRAEAHKPGQAEGFLDEA
CSEAERLLDEHNLTGIELLGPVPAPMERRAGRYRAQLLLQASARAPLHRLLSAWLLALEQ
MPSGRAVRWSLDVDPVDLY