Protein Info for AO353_12375 in Pseudomonas fluorescens FW300-N2E3

Annotation: sterol-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02036: SCP2" amino acids 14 to 112 (99 residues), 64 bits, see alignment E=7.1e-22

Best Hits

KEGG orthology group: K03690, hypothetical protein (inferred from 91% identity to pfo:Pfl01_0386)

Predicted SEED Role

"Protein YigP (COG3165) clustered with ubiquinone biosynthetic genes" in subsystem Ubiquinone Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WCA6 at UniProt or InterPro

Protein Sequence (207 amino acids)

>AO353_12375 sterol-binding protein (Pseudomonas fluorescens FW300-N2E3)
MLLAGLLASVELGLNRVLRLDSTALPRLAHLSGKVIAVDCRSPALQMFIVPSDEGLMLAA
HWAADADCTLRAPAASLLKLALSKDKTAVLHGPEVELDGDSGVLLELAAVLQDLELDWEY
ELSRWLGPVATQLLGGHLRSRARWYQQGFASLNQNLADYLAEESRALVGQREAEARFSEL
DQIKLDLERLEARFERLSRSLDSSDNA