Protein Info for AO353_12360 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR03188.
Original annotation: phosphoribosyl-ATP pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03188: phosphoribosyl-ATP diphosphatase
  • amino acids 5 to 92 (88 residues), 95.9 bits, E=6.7e-32
• PF01503: PRA-PH
  • amino acids 6 to 95 (90 residues), 51.5 bits, E=5.1e-18

Best Hits

Swiss-Prot: 98% identical to HIS2_PSEPF: Phosphoribosyl-ATP pyrophosphatase (hisE) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 98% identity to pba:PSEBR_a399)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Sequence Analysis Tools

See A0A0N9WJH9 at UniProt or InterPro

Protein Sequence (110 amino acids)

>AO353_12360 phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (Pseudomonas fluorescens FW300-N2E3)
MTDTLTRLAQVLEERKGAAADSSYVASLYHKGLNKILEKVGEESVETIIAAKDAAISGDC
SDVIYETADLWFHSMVMLAQLGQHPQAVLDELDRRFGLSGHVEKASRPSA