Protein Info for AO353_12345 in Pseudomonas fluorescens FW300-N2E3

Annotation: twin-arginine protein translocation system subunit TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 111 to 138 (28 residues), see Phobius details amino acids 161 to 186 (26 residues), see Phobius details amino acids 197 to 214 (18 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 13 to 230 (218 residues), 249.9 bits, see alignment E=1.2e-78 PF00902: TatC" amino acids 15 to 225 (211 residues), 238.5 bits, see alignment E=3.3e-75

Best Hits

Swiss-Prot: 71% identical to TATC_AZOCH: Sec-independent protein translocase protein TatC (tatC) from Azotobacter chroococcum mcd 1

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 92% identity to pfl:PFL_0420)

MetaCyc: 65% identical to twin arginine protein translocation system - TatC protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WHM7 at UniProt or InterPro

Protein Sequence (264 amino acids)

>AO353_12345 twin-arginine protein translocation system subunit TatC (Pseudomonas fluorescens FW300-N2E3)
MSDIPENDQHMPLVSHLTELRTRLLRCVAAIFLIFAGLFAFTQQIYTFVSIPLRQYLPAG
ATMIATDVSSPFLTPLKLTMMVSLFLAIPVILHQIWGFIAPGLYKHEKRIAVPLLVSSIL
LFYTGMAFAYFLVFPLIFKFFASATPAGVEMMTDITSYLDFVMTLFFAFGVAFEIPVAVV
LLVWIGVVDVKYLKKIRPYVVIGCFVVGMILTPPDIFSQTLLAVPMWLLFEIGIVFGSLV
SKREKPADDQPADDHNDQPPATQP