Protein Info for AO353_12255 in Pseudomonas fluorescens FW300-N2E3

Annotation: sulfonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 238 to 263 (26 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 297 to 306 (10 residues), see Phobius details amino acids 328 to 346 (19 residues), see Phobius details amino acids 358 to 380 (23 residues), see Phobius details amino acids 400 to 425 (26 residues), see Phobius details amino acids 437 to 454 (18 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 20 to 442 (423 residues), 164 bits, see alignment E=2.8e-52

Best Hits

KEGG orthology group: K03457, nucleobase:cation symporter-1, NCS1 family (inferred from 92% identity to pfl:PFL_0402)

Predicted SEED Role

"Cytosine/purine/uracil/thiamine/allantoin permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VP30 at UniProt or InterPro

Protein Sequence (488 amino acids)

>AO353_12255 sulfonate ABC transporter substrate-binding protein (Pseudomonas fluorescens FW300-N2E3)
MANDDRARSKPLIEKRSIDYIPEAERHGRLLSQFTLWLGANLQITAIVTGALAVVLGGDV
FWSLVGLLIGQLLGGGVMALHAAQGPQLGLPQMISSRVQFGVYGAVIPLVLVCLMYIGFS
ASGSLLAGQAVAQLLHVEDWVGITLFAGSIMVFTIFGYRVIHGIGRVASVLGVVAFIYLF
YKLLAGNDIGALLGNKHFSVASFLLAVSLSASWQIAFGPYVADYSRYLPRSTQAKKTFWA
VGLGSVIGAQASMVFGVFAAALAGSQFAHHEVSFIVSLGGTGIVAALLYFAVAFGKVTVT
TLNAYGSFMSIATIISGFRGSRHIGSGVRLLYIFIMVSLAAALALLGKDSFLKEFSAFIL
FLLAFFTPWSAINLVDFYCITKERYDIPALSNPEGRYGRWNIMGISIYVFGVLIQMPFIS
THFYTGPLVASLGDTDISWIIGLVVPAAMYYFAAKKWHSAVPDRLILPVEQDEAVKVKTS
GADSVAAI