Protein Info for AO353_12175 in Pseudomonas fluorescens FW300-N2E3

Annotation: tRNA s(4)U8 sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 TIGR00342: tRNA sulfurtransferase ThiI" amino acids 4 to 371 (368 residues), 333.5 bits, see alignment E=1.8e-103 PF02926: THUMP" amino acids 29 to 164 (136 residues), 66.4 bits, see alignment E=6.2e-22 PF02568: ThiI" amino acids 179 to 370 (192 residues), 204.6 bits, see alignment E=2.5e-64 TIGR04271: thiazole biosynthesis domain" amino acids 385 to 483 (99 residues), 120.1 bits, see alignment E=3.8e-39

Best Hits

Swiss-Prot: 92% identical to THII_PSEFS: tRNA sulfurtransferase (thiI) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03151, thiamine biosynthesis protein ThiI (inferred from 94% identity to pfl:PFL_0387)

MetaCyc: 50% identical to tRNA uridine 4-sulfurtransferase (Escherichia coli K-12 substr. MG1655)
tRNA sulfurtransferase. [EC: 2.8.1.4]; 2.8.1.- [EC: 2.8.1.4]

Predicted SEED Role

"tRNA S(4)U 4-thiouridine synthase (former ThiI) / Rhodanese-like domain required for thiamine synthesis" in subsystem Thiamin biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WUS8 at UniProt or InterPro

Protein Sequence (484 amino acids)

>AO353_12175 tRNA s(4)U8 sulfurtransferase (Pseudomonas fluorescens FW300-N2E3)
MKLIVKVFPEITIKSRPVRTRFIRQLAKNIRAVLRDLDPAVVVNGVWDNLELETHVSDPK
ALKDMTERLSCMPGIAHFLQVDEYPLGDFDDIVAKCKQHYGDSLAGKIFSVRCKRAGKHE
FSSMDVEKYVGSQLRRQCGAAGISLKQPEIEVRIEIRDKRLFVIHSQHNSIGGYPLGALE
QTLVLMSGGFDSTVAAYQIMRRGLMAHFCFFNLGGRAHELGVMEVAHFIWKKYGSSQRVL
FVSVPFEEVLGEILGKVDNSHMGVVLKRMMLRAASRIADRLDIEALVTGEAISQVSSQTL
PNLSVIDCVTDKLVLRPLIASHKQDIIDLANEIGTADFAKHMPEYCGVISVNPKTHAKRP
RVEHEEKEFDMAVLERALENAKLVPIDRVIDELGQDVQVEEVSEALAGQIIIDIRHPDAA
EDDPLELAGIEVQAMPFYALNARFKELDPTRQYLLYCDKGVMSRLHAHHLLSEGHANVRV
YRPS